Bachem Peptides

Awaiting product image

CRF (human, rat)

CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also […]

SKU: 4011473

Category: All Products, Applications, Peptides to Buy Online, Pituitary & Hypothalamic Hormones

Description
Additional information

Description

CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRH.

Additional information

Pack size available	1mg, 5mg

Related products

((R)-4-Hydroxy-4-methyl-Orn(5-TAMRA)⁷)-Phalloidin

$931.00

Select options
((R)-4-Hydroxy-4-methyl-Orn(CPM-β-Mpa)⁷)-Phalloidin

$202.20

Select options
((R)-4-Hydroxy-4-methyl-Orn(TRITC)⁷)-Phalloidin

$343.74

Select options
(2-(1,3-Dithiolan-2-yl)-Trp²⁵)-Liraglutide trifluoroacetate salt

Price range: $443.00 through $2,635.40

Select options
(2-Hydroxy-Trp²⁵)-Liraglutide trifluoroacetate salt

Price range: $443.00 through $2,635.40

Select options

Your cart (items: 0)

Products in cart
Product	Details	Total
	Available on backorder Previous price: Discounted price:	Save